SCOP 1.63: Domain d1dlhe1: 1dlh E:93-190

Lineage for d1dlhe1 (1dlh E:93-190)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (11 PDB entries)

8. Domain d1dlhe1: 1dlh E:93-190 [21600]
   Other proteins in same PDB: d1dlha2, d1dlhb2, d1dlhd2, d1dlhe2
   complexed with nag

Details for d1dlhe1

PDB Entry: 1dlh, 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

SCOP Domain Sequences for d1dlhe1:

Sequence; same for both SEQRES and ATOM records:

>d1dlhe1 b.1.1.2 (E:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d1dlhe1:

• d1dlhe1 first appeared (with stable ids) in SCOP 1.55
  
• d1dlhe1 appears in SCOP 1.61
  
• d1dlhe1 appears in SCOP 1.65
  
• d1dlhe1 appears in the current release, SCOPe 2.08