Lineage for d3rqia_ (3rqi A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838129Species Burkholderia pseudomallei [TaxId:320372] [226124] (1 PDB entry)
  8. 1838130Domain d3rqia_: 3rqi A: [215990]
    automated match to d1s8na_
    complexed with ca, cit, gol, so4

Details for d3rqia_

PDB Entry: 3rqi (more details), 1.7 Å

PDB Description: Crystal structure of a response regulator protein from Burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate
PDB Compounds: (A:) Response regulator protein

SCOPe Domain Sequences for d3rqia_:

Sequence, based on SEQRES records: (download)

>d3rqia_ c.23.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dknflviddnevfagtlarglerrgyavrqahnkdealklagaekfefitvdlhlgndsg
lsliaplcdlqpdarilvltgyasiatavqavkdgadnylakpanvesilaalqtnasev
qaeealenpvvlsvdrlewehiqrvlaennnnisataralnmhrrtlqrklak

Sequence, based on observed residues (ATOM records): (download)

>d3rqia_ c.23.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dknflviddnevfagtlarglerrgyavrqahnkdealklagaekfefitvdlhlgndsg
lsliaplcdlqpdarilvltgyasiatavqavkdgadnylakpanvesilaalqtnasev
qaeealenpvvlslewehiqrvlaennnnisataralnmhrrtlqrklak

SCOPe Domain Coordinates for d3rqia_:

Click to download the PDB-style file with coordinates for d3rqia_.
(The format of our PDB-style files is described here.)

Timeline for d3rqia_: