Lineage for d1dlhd1 (1dlh D:82-182)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288908Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 288913Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (23 PDB entries)
    probably orthologous to the mouse I-E group
  8. 288933Domain d1dlhd1: 1dlh D:82-182 [21599]
    Other proteins in same PDB: d1dlha2, d1dlhb1, d1dlhb2, d1dlhd2, d1dlhe1, d1dlhe2
    complexed with nag

Details for d1dlhd1

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

SCOP Domain Sequences for d1dlhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlhd1 b.1.1.2 (D:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOP Domain Coordinates for d1dlhd1:

Click to download the PDB-style file with coordinates for d1dlhd1.
(The format of our PDB-style files is described here.)

Timeline for d1dlhd1: