Lineage for d1dlhd1 (1dlh D:82-182)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159093Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries)
  8. 159112Domain d1dlhd1: 1dlh D:82-182 [21599]
    Other proteins in same PDB: d1dlha2, d1dlhb2, d1dlhd2, d1dlhe2

Details for d1dlhd1

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide
PDB Compounds: (D:)

SCOP Domain Sequences for d1dlhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlhd1 b.1.1.2 (D:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOP Domain Coordinates for d1dlhd1:

Click to download the PDB-style file with coordinates for d1dlhd1.
(The format of our PDB-style files is described here.)

Timeline for d1dlhd1: