SCOP 1.55: Domain d1dlhd1: 1dlh D:82-182

Lineage for d1dlhd1 (1dlh D:82-182)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries)

8. Domain d1dlhd1: 1dlh D:82-182 [21599]
   Other proteins in same PDB: d1dlha2, d1dlhb2, d1dlhd2, d1dlhe2

Details for d1dlhd1

PDB Entry: 1dlh, 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

SCOP Domain Sequences for d1dlhd1:

Sequence; same for both SEQRES and ATOM records:

>d1dlhd1 b.1.1.2 (D:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1dlhd1:

• d1dlhd1 appears in SCOP 1.57
  
• d1dlhd1 appears in the current release, SCOPe 2.08