SCOPe 2.08: Domain d1dlhd1: 1dlh D:82-182

Lineage for d1dlhd1 (1dlh D:82-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1dlhd1: 1dlh D:82-182 [21599]
   Other proteins in same PDB: d1dlha2, d1dlhb1, d1dlhb2, d1dlhd2, d1dlhe1, d1dlhe2
   complexed with nag

Details for d1dlhd1

PDB Entry: 1dlh, 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

PDB Compounds: (D:) class II histocompatibility antigen (hla-dr1) (alpha chain)

SCOPe Domain Sequences for d1dlhd1:

Sequence; same for both SEQRES and ATOM records:

>d1dlhd1 b.1.1.2 (D:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1dlhd1:

• d1dlhd1 first appeared (with stable ids) in SCOP 1.55
  
• d1dlhd1 appears in SCOPe 2.07