Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
Domain d3rpqb2: 3rpq B:138-208 [215980] Other proteins in same PDB: d3rpqa1, d3rpqb1 automated match to d1i5za1 complexed with cmp, po4 |
PDB Entry: 3rpq (more details), 2.61 Å
SCOPe Domain Sequences for d3rpqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rpqb2 a.4.5.0 (B:138-208) automated matches {Escherichia coli K-12 [TaxId: 83333]} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvygt
Timeline for d3rpqb2: