SCOP 1.61: Domain d1fytb1: 1fyt B:93-190

Lineage for d1fytb1 (1fyt B:93-190)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries)

8. Domain d1fytb1: 1fyt B:93-190 [21596]
   Other proteins in same PDB: d1fyta2, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2

Details for d1fytb1

PDB Entry: 1fyt, 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fytb1:

Sequence, based on SEQRES records:

>d1fytb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d1fytb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvml
etvprsgevytcqvehpsvtspltvewra

Timeline for d1fytb1:

• d1fytb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fytb1 appears in SCOP 1.59
  
• d1fytb1 appears in SCOP 1.63
  
• d1fytb1 appears in the current release, SCOPe 2.08