SCOPe 2.04: Domain d3rodb_: 3rod B:

Lineage for d3rodb_ (3rod B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (47 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187871] (9 PDB entries)

8. Domain d3rodb_: 3rod B: [215952]
   automated match to d2i62b_
   complexed with nca, sah

Details for d3rodb_

PDB Entry: 3rod, 2.72 Å

PDB Description: Methyltransferase

PDB Compounds: (B:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d3rodb_:

Sequence; same for both SEQRES and ATOM records:

>d3rodb_ c.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdllidi
gsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrv
kgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrn
lgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsy
sstmanneglfslvarkls

Timeline for d3rodb_:

• d3rodb_ first appeared in SCOPe 2.03
  
• d3rodb_ appears in SCOPe 2.05
  
• d3rodb_ appears in the current release, SCOPe 2.08