SCOP 1.61: Domain d1fyta1: 1fyt A:82-181

Lineage for d1fyta1 (1fyt A:82-181)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries)
Domain d1fyta1: 1fyt A:82-181 [21595]
Other proteins in same PDB: d1fyta2, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2

Details for d1fyta1

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyta1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1fyta1:

Click to download the PDB-style file with coordinates for d1fyta1.
(The format of our PDB-style files is described here.)

Timeline for d1fyta1: