SCOPe 2.08: Domain d1fyta1: 1fyt A:82-181

Lineage for d1fyta1 (1fyt A:82-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1fyta1: 1fyt A:82-181 [21595]
   Other proteins in same PDB: d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2
   complexed with nag

Details for d1fyta1

PDB Entry: 1fyt, 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1fyta1:

Sequence; same for both SEQRES and ATOM records:

>d1fyta1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1fyta1:

• d1fyta1 first appeared (with stable ids) in SCOP 1.55
  
• d1fyta1 appears in SCOPe 2.07