Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Paenibacillus sp. [TaxId:324057] [193799] (2 PDB entries) |
Domain d3ro8h_: 3ro8 H: [215948] automated match to d3rdkb_ complexed with cl, mg |
PDB Entry: 3ro8 (more details), 1.34 Å
SCOPe Domain Sequences for d3ro8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ro8h_ c.1.8.0 (H:) automated matches {Paenibacillus sp. [TaxId: 324057]} shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp dnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiar vtfw
Timeline for d3ro8h_: