Lineage for d3ro8g1 (3ro8 G:5-305)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832970Species Paenibacillus sp. [TaxId:324057] [193799] (3 PDB entries)
  8. 2832977Domain d3ro8g1: 3ro8 G:5-305 [215947]
    Other proteins in same PDB: d3ro8a2, d3ro8b2, d3ro8c2, d3ro8d2, d3ro8e2, d3ro8f2, d3ro8g2, d3ro8h2
    automated match to d3rdkb_
    complexed with cl, mg

Details for d3ro8g1

PDB Entry: 3ro8 (more details), 1.34 Å

PDB Description: Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2
PDB Compounds: (G:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3ro8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ro8g1 c.1.8.0 (G:5-305) automated matches {Paenibacillus sp. [TaxId: 324057]}
aplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftftaa
damidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvmk
hfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenps
wniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdnv
klslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiarvtf
w

SCOPe Domain Coordinates for d3ro8g1:

Click to download the PDB-style file with coordinates for d3ro8g1.
(The format of our PDB-style files is described here.)

Timeline for d3ro8g1: