SCOPe 2.06: Domain d3ro8b1: 3ro8 B:5-305

Lineage for d3ro8b1 (3ro8 B:5-305)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Paenibacillus sp. [TaxId:324057] [193799] (3 PDB entries)

8. Domain d3ro8b1: 3ro8 B:5-305 [215942]
   Other proteins in same PDB: d3ro8a2, d3ro8b2, d3ro8c2, d3ro8d2, d3ro8e2, d3ro8f2, d3ro8g2, d3ro8h2
   automated match to d3rdkb_
   complexed with cl, mg

Details for d3ro8b1

PDB Entry: 3ro8, 1.34 Å

PDB Description: Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2

PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3ro8b1:

Sequence; same for both SEQRES and ATOM records:

>d3ro8b1 c.1.8.0 (B:5-305) automated matches {Paenibacillus sp. [TaxId: 324057]}
aplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftftaa
damidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvmk
hfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenps
wniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdnv
klslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiarvtf
w

Timeline for d3ro8b1:

• d3ro8b1 first appeared in SCOPe 2.03, called d3ro8b_
  
• d3ro8b1 was called d3ro8b_ in SCOPe 2.05
  
• d3ro8b1 appears in SCOPe 2.07
  
• d3ro8b1 appears in the current release, SCOPe 2.08