SCOPe 2.02: Domain d2sebb1: 2seb B:93-190

Lineage for d2sebb1 (2seb B:93-190)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d2sebb1: 2seb B:93-190 [21594]
   Other proteins in same PDB: d2seba1, d2seba2, d2sebb2, d2sebd1, d2sebd2
   complexed with nag

Details for d2sebb1

PDB Entry: 2seb, 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d2sebb1:

Sequence, based on SEQRES records:

>d2sebb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Sequence, based on observed residues (ATOM records):

>d2sebb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypanllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvm
letvevytcqvehpsltspltvewra

Timeline for d2sebb1:

• d2sebb1 first appeared (with stable ids) in SCOP 1.55
  
• d2sebb1 appears in SCOPe 2.01
  
• d2sebb1 appears in SCOPe 2.03
  
• d2sebb1 appears in the current release, SCOPe 2.08