Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries) |
Domain d2sebb1: 2seb B:93-190 [21594] Other proteins in same PDB: d2seba2, d2sebb2, d2sebd1, d2sebd2 |
PDB Entry: 2seb (more details), 2.5 Å
SCOP Domain Sequences for d2sebb1:
Sequence, based on SEQRES records: (download)
>d2sebb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd wtfqtlvmletvprsgevytcqvehpsltspltvewra
>d2sebb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} rrvypevtvypanllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvm letvevytcqvehpsltspltvewra
Timeline for d2sebb1:
View in 3D Domains from other chains: (mouse over for more information) d2seba1, d2seba2, d2sebd1, d2sebd2 |