SCOPe 2.03: Domain d3ro6d1: 3ro6 D:1-125

Lineage for d3ro6d1 (3ro6 D:1-125)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries)

8. Domain d3ro6d1: 3ro6 D:1-125 [215934]
   Other proteins in same PDB: d3ro6a2, d3ro6b2, d3ro6c2, d3ro6d2, d3ro6e2, d3ro6f2
   automated match to d1jpma2
   complexed with gol, mg, so4

Details for d3ro6d1

PDB Entry: 3ro6, 2.2 Å

PDB Description: crystal structure of dipeptide epimerase from methylococcus capsulatus complexed with mg ion

PDB Compounds: (D:) Putative chloromuconate cycloisomerase

SCOPe Domain Sequences for d3ro6d1:

Sequence, based on SEQRES records:

>d3ro6d1 d.54.1.0 (D:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
eilgr

Sequence, based on observed residues (ATOM records):

>d3ro6d1 d.54.1.0 (D:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfplteidnliveirtadgllglgaasperhvtgetleachaaldhdrl
gwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgr

Timeline for d3ro6d1:

• d3ro6d1 is new in SCOPe 2.03-stable
  
• d3ro6d1 appears in SCOPe 2.04
  
• d3ro6d1 appears in the current release, SCOPe 2.08