SCOP 1.65: Domain d2seba1: 2seb A:82-180

Lineage for d2seba1 (2seb A:82-180)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (23 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d2seba1: 2seb A:82-180 [21593]
   Other proteins in same PDB: d2seba2, d2sebb1, d2sebb2, d2sebd1, d2sebd2
   complexed with nag

Details for d2seba1

PDB Entry: 2seb, 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2seba1:

Sequence; same for both SEQRES and ATOM records:

>d2seba1 b.1.1.2 (A:82-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d2seba1:

• d2seba1 first appeared (with stable ids) in SCOP 1.55
  
• d2seba1 appears in SCOP 1.63
  
• d2seba1 appears in SCOP 1.67
  
• d2seba1 appears in the current release, SCOPe 2.08