![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (11 PDB entries) |
![]() | Domain d2seba1: 2seb A:82-180 [21593] Other proteins in same PDB: d2seba2, d2sebb2, d2sebd1, d2sebd2 |
PDB Entry: 2seb (more details), 2.5 Å
SCOP Domain Sequences for d2seba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2seba1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwef
Timeline for d2seba1:
![]() Domains from other chains: (mouse over for more information) d2sebb1, d2sebb2, d2sebd1, d2sebd2 |