SCOP 1.61: Domain d2seba1: 2seb A:82-180

Lineage for d2seba1 (2seb A:82-180)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries)

8. Domain d2seba1: 2seb A:82-180 [21593]
   Other proteins in same PDB: d2seba2, d2sebb2, d2sebd1, d2sebd2

Details for d2seba1

PDB Entry: 2seb, 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2seba1:

Sequence; same for both SEQRES and ATOM records:

>d2seba1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d2seba1:

• d2seba1 first appeared (with stable ids) in SCOP 1.55
  
• d2seba1 appears in SCOP 1.59
  
• d2seba1 appears in SCOP 1.63
  
• d2seba1 appears in the current release, SCOPe 2.08