Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries) |
Domain d2seba1: 2seb A:82-180 [21593] Other proteins in same PDB: d2seba2, d2sebb2, d2sebd1, d2sebd2 |
PDB Entry: 2seb (more details), 2.5 Å
SCOP Domain Sequences for d2seba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2seba1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwef
Timeline for d2seba1:
View in 3D Domains from other chains: (mouse over for more information) d2sebb1, d2sebb2, d2sebd1, d2sebd2 |