Lineage for d2seba1 (2seb A:82-180)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. 8378Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries)
  8. 8387Domain d2seba1: 2seb A:82-180 [21593]
    Other proteins in same PDB: d2seba2, d2sebb2, d2sebd1, d2sebd2

Details for d2seba1

PDB Entry: 2seb (more details), 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
PDB Compounds: (A:)

SCOP Domain Sequences for d2seba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2seba1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOP Domain Coordinates for d2seba1:

Click to download the PDB-style file with coordinates for d2seba1.
(The format of our PDB-style files is described here.)

Timeline for d2seba1: