SCOPe 2.08: Domain d3rn4a1: 3rn4 A:9-102

Lineage for d3rn4a1 (3rn4 A:9-102)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226251] (2 PDB entries)

8. Domain d3rn4a1: 3rn4 A:9-102 [215923]
   Other proteins in same PDB: d3rn4a2
   automated match to d1p7ga1
   complexed with fe

Details for d3rn4a1

PDB Entry: 3rn4, 1.79 Å

PDB Description: Crystal structure of iron-substituted Sod2 from Saccharomyces cerevisiae

PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3rn4a1:

Sequence; same for both SEQRES and ATOM records:

>d3rn4a1 a.2.11.0 (A:9-102) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlapesqg

Timeline for d3rn4a1:

• d3rn4a1 first appeared in SCOPe 2.03
  
• d3rn4a1 appears in SCOPe 2.07