Lineage for d1aqdk1 (1aqd K:93-191)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. 8378Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries)
  8. 8386Domain d1aqdk1: 1aqd K:93-191 [21592]
    Other proteins in same PDB: d1aqda2, d1aqdb2, d1aqdd2, d1aqde2, d1aqdg2, d1aqdh2, d1aqdj2, d1aqdk2

Details for d1aqdk1

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqdk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqdk1 b.1.1.2 (K:93-191) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrar

SCOP Domain Coordinates for d1aqdk1:

Click to download the PDB-style file with coordinates for d1aqdk1.
(The format of our PDB-style files is described here.)

Timeline for d1aqdk1: