Lineage for d3rkua_ (3rku A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580328Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225295] (2 PDB entries)
  8. 1580329Domain d3rkua_: 3rku A: [215910]
    automated match to d3tsca_
    complexed with nap

Details for d3rkua_

PDB Entry: 3rku (more details), 2.6 Å

PDB Description: Substrate Fingerprint and the Structure of NADP+ Dependent Serine Dehydrogenase from Saccharomyces cerevisiae complexed with NADP+
PDB Compounds: (A:) Oxidoreductase YMR226C

SCOPe Domain Sequences for d3rkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rkua_ c.2.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmsqgrkaaerlakktvlitgasagigkataleyleasngdmklilaarrlekleelkkt
idqefpnakvhvaqlditqaekikpfienlpqefkdidilvnnagkalgsdrvgqiated
iqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrdayptgsiycaskfavgaft
dslrkelintkirviliapglvetefslvryrgneeqaknvykdttplmaddvadlivya
tsrkqntviadtlifptnqasphhifrg

SCOPe Domain Coordinates for d3rkua_:

Click to download the PDB-style file with coordinates for d3rkua_.
(The format of our PDB-style files is described here.)

Timeline for d3rkua_: