Lineage for d1aqdh1 (1aqd H:93-190)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288980Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 288985Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (23 PDB entries)
    probably orthologous to the mouse I-E group
  8. 288996Domain d1aqdh1: 1aqd H:93-190 [21590]
    Other proteins in same PDB: d1aqda1, d1aqda2, d1aqdb2, d1aqdd1, d1aqdd2, d1aqde2, d1aqdg1, d1aqdg2, d1aqdh2, d1aqdj1, d1aqdj2, d1aqdk2

Details for d1aqdh1

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqdh1 b.1.1.2 (H:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1aqdh1:

Click to download the PDB-style file with coordinates for d1aqdh1.
(The format of our PDB-style files is described here.)

Timeline for d1aqdh1: