SCOP 1.55: Domain d1aqdh1: 1aqd H:93-190

Lineage for d1aqdh1 (1aqd H:93-190)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries)

8. Domain d1aqdh1: 1aqd H:93-190 [21590]
   Other proteins in same PDB: d1aqda2, d1aqdb2, d1aqdd2, d1aqde2, d1aqdg2, d1aqdh2, d1aqdj2, d1aqdk2

Details for d1aqdh1

PDB Entry: 1aqd, 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqdh1:

Sequence; same for both SEQRES and ATOM records:

>d1aqdh1 b.1.1.2 (H:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d1aqdh1:

• d1aqdh1 appears in SCOP 1.57
  
• d1aqdh1 appears in the current release, SCOPe 2.08