SCOPe 2.02: Domain d1aqdg1: 1aqd G:82-179

Lineage for d1aqdg1 (1aqd G:82-179)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1aqdg1: 1aqd G:82-179 [21589]
   Other proteins in same PDB: d1aqda2, d1aqdb1, d1aqdb2, d1aqdd2, d1aqde1, d1aqde2, d1aqdg2, d1aqdh1, d1aqdh2, d1aqdj2, d1aqdk1, d1aqdk2

Details for d1aqdg1

PDB Entry: 1aqd, 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

PDB Compounds: (G:) hla-dr1 class II histocompatibility protein

SCOPe Domain Sequences for d1aqdg1:

Sequence; same for both SEQRES and ATOM records:

>d1aqdg1 b.1.1.2 (G:82-179) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwe

Timeline for d1aqdg1:

• d1aqdg1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqdg1 appears in SCOPe 2.01
  
• d1aqdg1 appears in SCOPe 2.03
  
• d1aqdg1 appears in the current release, SCOPe 2.08