![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries) |
![]() | Domain d1aqde1: 1aqd E:93-190 [21588] Other proteins in same PDB: d1aqda2, d1aqdb2, d1aqdd2, d1aqde2, d1aqdg2, d1aqdh2, d1aqdj2, d1aqdk2 |
PDB Entry: 1aqd (more details), 2.45 Å
SCOP Domain Sequences for d1aqde1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqde1 b.1.1.2 (E:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d1aqde1: