SCOPe 2.04: Domain d3ritb2: 3rit B:126-354

Lineage for d3ritb2 (3rit B:126-354)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:414] [226117] (2 PDB entries)

8. Domain d3ritb2: 3rit B:126-354 [215858]
   Other proteins in same PDB: d3rita1, d3ritb1, d3ritc1, d3ritd1, d3rite1
   automated match to d1jpma1
   complexed with 1pe, arg, dly, mg, so4

Details for d3ritb2

PDB Entry: 3rit, 2.7 Å

PDB Description: Crystal structure of Dipeptide Epimerase from Methylococcus capsulatus complexed with Mg and dipeptide L-Arg-D-Lys

PDB Compounds: (B:) Dipeptide Epimerase

SCOPe Domain Sequences for d3ritb2:

Sequence; same for both SEQRES and ATOM records:

>d3ritb2 c.1.11.0 (B:126-354) automated matches {Methylococcus capsulatus [TaxId: 414]}
ahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagra
vvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesll
gpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaa
lhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvy

Timeline for d3ritb2:

• d3ritb2 first appeared in SCOPe 2.03
  
• d3ritb2 appears in SCOPe 2.05
  
• d3ritb2 appears in the current release, SCOPe 2.08