Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (59 species) not a true protein |
Species Methylococcus capsulatus [TaxId:414] [226117] (2 PDB entries) |
Domain d3ritb2: 3rit B:126-354 [215858] Other proteins in same PDB: d3rita1, d3ritb1, d3ritc1, d3ritd1, d3rite1 automated match to d1jpma1 complexed with 1pe, arg, dly, mg, so4 |
PDB Entry: 3rit (more details), 2.7 Å
SCOPe Domain Sequences for d3ritb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ritb2 c.1.11.0 (B:126-354) automated matches {Methylococcus capsulatus [TaxId: 414]} ahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagra vvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesll gpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaa lhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvy
Timeline for d3ritb2: