Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88626] (1 PDB entry) probably orthologous to the mouse H2-DM |
Domain d1hdmb1: 1hdm B:88-185 [21584] Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb2 |
PDB Entry: 1hdm (more details), 2.5 Å
SCOP Domain Sequences for d1hdmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM} trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmhssahktaqpngdw tyqtlshlaltpsygdtytcvvehigapepilrdwtpg
Timeline for d1hdmb1: