Lineage for d1hdmb1 (1hdm B:88-185)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288980Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 288981Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88626] (1 PDB entry)
    probably orthologous to the mouse H2-DM
  8. 288982Domain d1hdmb1: 1hdm B:88-185 [21584]
    Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb2

Details for d1hdmb1

PDB Entry: 1hdm (more details), 2.5 Å

PDB Description: histocompatibility antigen hla-dm

SCOP Domain Sequences for d1hdmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM}
trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmhssahktaqpngdw
tyqtlshlaltpsygdtytcvvehigapepilrdwtpg

SCOP Domain Coordinates for d1hdmb1:

Click to download the PDB-style file with coordinates for d1hdmb1.
(The format of our PDB-style files is described here.)

Timeline for d1hdmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdmb2