![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88626] (1 PDB entry) probably orthologous to the mouse H2-DM |
![]() | Domain d1hdmb1: 1hdm B:88-185 [21584] Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb2 |
PDB Entry: 1hdm (more details), 2.5 Å
SCOP Domain Sequences for d1hdmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM} trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmhssahktaqpngdw tyqtlshlaltpsygdtytcvvehigapepilrdwtpg
Timeline for d1hdmb1: