Lineage for d1hdmb1 (1hdm B:88-185)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220735Species Human (Homo sapiens), HLA-DM [TaxId:9606] [49133] (1 PDB entry)
  8. 220737Domain d1hdmb1: 1hdm B:88-185 [21584]
    Other proteins in same PDB: d1hdma2, d1hdmb2

Details for d1hdmb1

PDB Entry: 1hdm (more details), 2.5 Å

PDB Description: histocompatibility antigen hla-dm

SCOP Domain Sequences for d1hdmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DM}
trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmhssahktaqpngdw
tyqtlshlaltpsygdtytcvvehigapepilrdwtpg

SCOP Domain Coordinates for d1hdmb1:

Click to download the PDB-style file with coordinates for d1hdmb1.
(The format of our PDB-style files is described here.)

Timeline for d1hdmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdmb2