SCOPe 2.04: Domain d1hdma1: 1hdm A:94-196

Lineage for d1hdma1 (1hdm A:94-196)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88619] (1 PDB entry)
   probably orthologous to the mouse H2-DM

8. Domain d1hdma1: 1hdm A:94-196 [21583]
   Other proteins in same PDB: d1hdma2, d1hdmb1, d1hdmb2

Details for d1hdma1

PDB Entry: 1hdm, 2.5 Å

PDB Description: histocompatibility antigen hla-dm

PDB Compounds: (A:) protein (class II histocompatibility antigen, m alpha chain)

SCOPe Domain Sequences for d1hdma1:

Sequence; same for both SEQRES and ATOM records:

>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwhdhsvpvegfgptfvsavdgl
sfqafsylnftpepsdifscivthepdrytaiaywvprnalps

Timeline for d1hdma1:

• d1hdma1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdma1 appears in SCOPe 2.03
  
• d1hdma1 appears in SCOPe 2.05
  
• d1hdma1 appears in the current release, SCOPe 2.08