Lineage for d1cd1c1 (1cd1 C:186-279)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548555Protein CD1, alpha-3 domain [88615] (3 species)
  7. 548563Species Mouse (Mus musculus) [TaxId:10090] [88616] (1 PDB entry)
  8. 548565Domain d1cd1c1: 1cd1 C:186-279 [21581]
    Other proteins in same PDB: d1cd1a2, d1cd1b_, d1cd1c2, d1cd1d_

Details for d1cd1c1

PDB Entry: 1cd1 (more details), 2.67 Å

PDB Description: cd1(mouse) antigen presenting molecule

SCOP Domain Sequences for d1cd1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd1c1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus)}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOP Domain Coordinates for d1cd1c1:

Click to download the PDB-style file with coordinates for d1cd1c1.
(The format of our PDB-style files is described here.)

Timeline for d1cd1c1: