Lineage for d3rgdj_ (3rgd J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1728574Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries)
  8. 1728666Domain d3rgdj_: 3rgd J: [215804]
    Other proteins in same PDB: d3rgdf_, d3rgdg_, d3rgdh_, d3rgdi_, d3rgdn_, d3rgdr_, d3rgds_, d3rgdt_, d3rgdx_
    automated match to d3ka4a_
    complexed with fe

Details for d3rgdj_

PDB Entry: 3rgd (more details), 2.89 Å

PDB Description: iron loaded frog m ferritin. short soaking time
PDB Compounds: (J:) Ferritin, middle subunit

SCOPe Domain Sequences for d3rgdj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgdj_ a.25.1.1 (J:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk

SCOPe Domain Coordinates for d3rgdj_:

Click to download the PDB-style file with coordinates for d3rgdj_.
(The format of our PDB-style files is described here.)

Timeline for d3rgdj_: