SCOP 1.71: Domain d1cd1b_: 1cd1 B:

Lineage for d1cd1b_ (1cd1 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)

8. Domain d1cd1b_: 1cd1 B: [21580]
   Other proteins in same PDB: d1cd1a1, d1cd1a2, d1cd1c1, d1cd1c2

Details for d1cd1b_

PDB Entry: 1cd1, 2.67 Å

PDB Description: cd1(mouse) antigen presenting molecule

SCOP Domain Sequences for d1cd1b_:

Sequence; same for both SEQRES and ATOM records:

>d1cd1b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1cd1b_:

• d1cd1b_ first appeared (with stable ids) in SCOP 1.55, called d1cd1b1
  
• d1cd1b_ appears in SCOP 1.69
  
• d1cd1b_ appears in SCOP 1.73
  
• d1cd1b_ appears in the current release, SCOPe 2.08