Lineage for d1cd1b1 (1cd1 B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8164Protein CD1, beta2-microglobulin and alpha-3 domain [49130] (1 species)
  7. 8165Species Mouse (Mus musculus) [TaxId:10090] [49131] (1 PDB entry)
  8. 8167Domain d1cd1b1: 1cd1 B: [21580]
    Other proteins in same PDB: d1cd1a2, d1cd1c2

Details for d1cd1b1

PDB Entry: 1cd1 (more details), 2.67 Å

PDB Description: cd1(mouse) antigen presenting molecule

SCOP Domain Sequences for d1cd1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd1b1 b.1.1.2 (B:) CD1, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1cd1b1:

Click to download the PDB-style file with coordinates for d1cd1b1.
(The format of our PDB-style files is described here.)

Timeline for d1cd1b1: