Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (24 species) not a true protein |
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (18 PDB entries) |
Domain d3rgdc_: 3rgd C: [215797] Other proteins in same PDB: d3rgdf_, d3rgdg_, d3rgdh_, d3rgdi_, d3rgdn_, d3rgdr_, d3rgds_, d3rgdt_, d3rgdx_ automated match to d3ka4a_ complexed with fe |
PDB Entry: 3rgd (more details), 2.89 Å
SCOPe Domain Sequences for d3rgdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgdc_ a.25.1.1 (C:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d3rgdc_: