Lineage for d1cd1a1 (1cd1 A:186-279)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291386Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1291415Species Mouse (Mus musculus) [TaxId:10090] [88616] (11 PDB entries)
  8. 1291424Domain d1cd1a1: 1cd1 A:186-279 [21579]
    Other proteins in same PDB: d1cd1a2, d1cd1b_, d1cd1c2, d1cd1d_

Details for d1cd1a1

PDB Entry: 1cd1 (more details), 2.67 Å

PDB Description: cd1(mouse) antigen presenting molecule
PDB Compounds: (A:) cd1

SCOPe Domain Sequences for d1cd1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd1a1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d1cd1a1:

Click to download the PDB-style file with coordinates for d1cd1a1.
(The format of our PDB-style files is described here.)

Timeline for d1cd1a1: