Lineage for d3rfca1 (3rfc A:2-139)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120847Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2120848Protein automated matches [226903] (35 species)
    not a true protein
  7. 2121003Species Xanthomonas oryzae [TaxId:342109] [225704] (4 PDB entries)
  8. 2121005Domain d3rfca1: 3rfc A:2-139 [215788]
    Other proteins in same PDB: d3rfca2
    automated match to d1ehia1
    complexed with adp, mg

Details for d3rfca1

PDB Entry: 3rfc (more details), 2.1 Å

PDB Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP
PDB Compounds: (A:) D-alanine--D-alanine ligase 1

SCOPe Domain Sequences for d3rfca1:

Sequence, based on SEQRES records: (download)

>d3rfca1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvfpivhgtlgedgslqgllr
manlpfvgsgvlgsavam

Sequence, based on observed residues (ATOM records): (download)

>d3rfca1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqqalaqidvvfpivhgtlgedgslqgllrma
nlpfvgsgvlgsavam

SCOPe Domain Coordinates for d3rfca1:

Click to download the PDB-style file with coordinates for d3rfca1.
(The format of our PDB-style files is described here.)

Timeline for d3rfca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rfca2