SCOPe 2.03: Domain d3revb1: 3rev B:3-115

Lineage for d3revb1 (3rev B:3-115)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)

8. Domain d3revb1: 3rev B:3-115 [215784]
   Other proteins in same PDB: d3reva1, d3reva2, d3revb2
   automated match to d1qrne1
   complexed with edo

Details for d3revb1

PDB Entry: 3rev, 2.2 Å

PDB Description: Crystal structure of human alloreactive tcr nb20

PDB Compounds: (B:) tcr nb20 beta chain

SCOPe Domain Sequences for d3revb1:

Sequence; same for both SEQRES and ATOM records:

>d3revb1 b.1.1.1 (B:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvsqnneqffgpgtrltvled

Timeline for d3revb1:

• d3revb1 is new in SCOPe 2.03-stable
  
• d3revb1 appears in SCOPe 2.04
  
• d3revb1 appears in the current release, SCOPe 2.08