Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries) |
Domain d3revb1: 3rev B:3-115 [215784] Other proteins in same PDB: d3reva1, d3reva2, d3revb2 automated match to d1qrne1 complexed with edo |
PDB Entry: 3rev (more details), 2.2 Å
SCOPe Domain Sequences for d3revb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3revb1 b.1.1.1 (B:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn gynvsrsttedfplrllsaapsqtsvyfcassyvsqnneqffgpgtrltvled
Timeline for d3revb1: