SCOPe 2.07: Domain d3reva2: 3rev A:118-205

Lineage for d3reva2 (3rev A:118-205)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d3reva2: 3rev A:118-205 [215783]
   Other proteins in same PDB: d3reva1, d3revb1
   automated match to d1qrnd2
   complexed with edo

Details for d3reva2

PDB Entry: 3rev, 2.2 Å

PDB Description: Crystal structure of human alloreactive tcr nb20

PDB Compounds: (A:) tcr nb20 alpha chain

SCOPe Domain Sequences for d3reva2:

Sequence, based on SEQRES records:

>d3reva2 b.1.1.2 (A:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d3reva2 b.1.1.2 (A:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkfacanafnnsiipedtffp

Timeline for d3reva2:

• d3reva2 first appeared in SCOPe 2.03
  
• d3reva2 appears in SCOPe 2.06
  
• d3reva2 appears in the current release, SCOPe 2.08