SCOP 1.73: Domain d1qsfe2: 1qsf E:119-246

Lineage for d1qsfe2 (1qsf E:119-246)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (16 PDB entries)
Domain d1qsfe2: 1qsf E:119-246 [21578]
Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb_, d1qsfd1, d1qsfe1

Details for d1qsfe2

PDB Entry: 1qsf (more details), 2.8 Å

PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a

PDB Compounds: (E:) hla-a 0201

SCOP Domain Sequences for d1qsfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsfe2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewaqdrakpvtqivs
aeawgrad

SCOP Domain Coordinates for d1qsfe2:

Click to download the PDB-style file with coordinates for d1qsfe2.
(The format of our PDB-style files is described here.)

Timeline for d1qsfe2: