![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (24 species) not a true protein |
![]() | Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries) |
![]() | Domain d3re7s_: 3re7 S: [215766] automated match to d3ka4a_ complexed with cu |
PDB Entry: 3re7 (more details), 2.82 Å
SCOPe Domain Sequences for d3re7s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3re7s_ a.25.1.1 (S:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d3re7s_: