SCOP 1.71: Domain d1qrne2: 1qrn E:119-246

Lineage for d1qrne2 (1qrn E:119-246)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (11 PDB entries)
Domain d1qrne2: 1qrn E:119-246 [21576]
Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb_, d1qrnd1, d1qrne1

Details for d1qrne2

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrne2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
lknvfppevavfepsaeeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOP Domain Coordinates for d1qrne2:

Click to download the PDB-style file with coordinates for d1qrne2.
(The format of our PDB-style files is described here.)

Timeline for d1qrne2: