SCOP 1.61: Domain d1bd2e2: 1bd2 E:119-247

Lineage for d1bd2e2 (1bd2 E:119-247)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (8 PDB entries)

8. Domain d1bd2e2: 1bd2 E:119-247 [21574]
   Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b1, d1bd2d1, d1bd2e1

Details for d1bd2e2

PDB Entry: 1bd2, 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201

SCOP Domain Sequences for d1bd2e2:

Sequence; same for both SEQRES and ATOM records:

>d1bd2e2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d1bd2e2:

• d1bd2e2 first appeared (with stable ids) in SCOP 1.55
  
• d1bd2e2 appears in SCOP 1.59
  
• d1bd2e2 appears in SCOP 1.63
  
• d1bd2e2 appears in the current release, SCOPe 2.08