SCOPe 2.02: Domain d1fyte2: 1fyt E:119-246

Lineage for d1fyte2 (1fyt E:119-246)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
Domain d1fyte2: 1fyt E:119-246 [21573]
Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fyte1
complexed with nag

Details for d1fyte2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

PDB Compounds: (E:) T-cell receptor beta chain

SCOPe Domain Sequences for d1fyte2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyte2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d1fyte2:

Click to download the PDB-style file with coordinates for d1fyte2.
(The format of our PDB-style files is described here.)

Timeline for d1fyte2: