Lineage for d1g6rb2 (1g6r B:118-247)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935181Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 935208Domain d1g6rb2: 1g6r B:118-247 [21571]
    Other proteins in same PDB: d1g6ra1, d1g6rb1, d1g6rc1, d1g6rd1, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl_, d1g6rm_

Details for d1g6rb2

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
PDB Compounds: (B:) beta t cell receptor

SCOPe Domain Sequences for d1g6rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOPe Domain Coordinates for d1g6rb2:

Click to download the PDB-style file with coordinates for d1g6rb2.
(The format of our PDB-style files is described here.)

Timeline for d1g6rb2: