SCOP 1.55: Domain d1g6rb2: 1g6r B:118-247

Lineage for d1g6rb2 (1g6r B:118-247)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (4 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (7 PDB entries)

8. Domain d1g6rb2: 1g6r B:118-247 [21571]
   Other proteins in same PDB: d1g6ra1, d1g6rb1, d1g6rc1, d1g6rd1, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl1, d1g6rm1

Details for d1g6rb2

PDB Entry: 1g6r, 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6rb2:

Sequence; same for both SEQRES and ATOM records:

>d1g6rb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

Timeline for d1g6rb2:

• d1g6rb2 appears in SCOP 1.57
  
• d1g6rb2 appears in the current release, SCOPe 2.08