Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (22 species) not a true protein |
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (12 PDB entries) |
Domain d3rbcb_: 3rbc B: [215694] automated match to d3ka4a_ complexed with fe |
PDB Entry: 3rbc (more details), 2.7 Å
SCOPe Domain Sequences for d3rbcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rbcb_ a.25.1.1 (B:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]} mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d3rbcb_: